Recombinant Human ZNF335 Protein

Recombinant Human ZNF335 Protein
SKU
ASBPP-10406-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9H4Z2

Gene Name: ZNF335

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Ala1201

End Site: Ala1340

Coverage: 0.11

Isoelectric Point: 4.5

Core Sequence: AYIQEITTADGQTVQHLVTSDNQVQYIISQDGVQHLLPQEYVVVPEGHHIQVQEGQITHIQYEQGAPFLQESQIQYVPVSPGQQLVTQAQLEAAAHSAVTAVADAAMAQAQGLFGTDETVPEHIQQLQHQGIEYDVITLA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 94%, Pig - 96%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Zinc finger protein 335; NRC-interacting factor 1; NIF-1

Protein name: zinc finger protein 335

Full length: 1342 amino acids

Entry name: ZN335_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10406-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10406-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 63925
Product information (PDF)
×
MSDS (PDF)
×