Recombinant Human ZNF345 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q14585

Gene Name: ZNF345

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Thr281

End Site: Gly380

Coverage: 0.21

Isoelectric Point: 8

Core Sequence: TGEKPYVCKECGKAFNSGSDLTQHQRIHTGEKPYECKECEKAFRSGSKLIQHQRMHTGEKPYECKECGKTFSSGSDLTQHHRIHTGEKPYECKECGKAFG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Rat - 73%, Pig - 88%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Zinc finger protein 345; Zinc finger protein HZF10

Protein name: zinc finger protein 345

Full length: 488 amino acids

Entry name: ZN345_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3623-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3623-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 25850