Recombinant Human ZNF347 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96SE7

Gene Name: ZNF347

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Gln121

End Site: Val210

Coverage: 0.12

Isoelectric Point: 6.5

Core Sequence: QESQDIEGCSFREVQKNTHGLEYQCRDAEGNYKGVLLTQEGNLTHGRDEHDKRDARNKLIKNQLGLSLQSHLPELQLFQYEGKIYECNQV

Homologies: Highest protein sequence identity to the following orthologs: Pig - 35%, Cynomolgus monkey - 94%

Alternative gene names: ZNF1111

Alternative protein names: Zinc finger protein 347; Zinc finger protein 1111

Protein name: zinc finger protein 347

Full length: 839 amino acids

Entry name: ZN347_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3505-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3505-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 84671