Recombinant Human ZNF354A Protein

Recombinant Human ZNF354A Protein
SKU
ASBPP-3412-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O60765

Gene Name: ZNF354A

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Gln11

End Site: Gly140

Coverage: 0.23

Isoelectric Point: 10

Core Sequence: QVSLTFEDVAVLFTRDEWRKLAPSQRNLYRDVMLENYRNLVSLGLPFTKPKVISLLQQGEDPWEVEKDGSGVSSLGSKSSHKTTKSTQTQDSSFQGLILKRSNRNVPWDLKLEKPYIYEGRLEKKQDKKG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Rat - 67%, Pig - 80%, Cynomolgus monkey - 78%

Alternative gene names: EZNF; HKL1; TCF17

Alternative protein names: Zinc finger protein 354A; Transcription factor 17; TCF-17; Zinc finger protein eZNF

Protein name: zinc finger protein 354A

Full length: 605 amino acids

Entry name: Z354A_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3412-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3412-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 6940
Product information (PDF)
×
MSDS (PDF)
×