Recombinant Human ZNF355P Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NSJ1

Gene Name: ZNF355P

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 64%

Start Site: Pro71

End Site: His150

Coverage: 0.18

Isoelectric Point: 10

Core Sequence: PYKCKDCGKIFKWSSNLTIHQRIHSGEKPYKCEECGKAFKQSSKLNEHMRAHTGEKFYKCEECGKAFKHPSGLTLHKRIH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 64%, Rat - 68%, Pig - 64%, Cynomolgus monkey - 77%

Alternative gene names: ZNF834

Alternative protein names: Putative zinc finger protein 355P; Zinc finger protein ZnFP01

Protein name: zinc finger protein 355, pseudogene

Full length: 428 amino acids

Entry name: Z355P_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3615-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3615-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 100505852