Recombinant Human ZNF362 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q5T0B9

Gene Name: ZNF362

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Met31

End Site: Thr220

Coverage: 0.46

Isoelectric Point: 10.5

Core Sequence: MPSQLDNLVLINKIKEQLMAEKIRPPHLPPTSASSQQPLLVPPAPAESSQAVMSLPKLQQVPGLHPQAVPQPDVALHARPATSTVTGLGLSTRTPSVSTSESSAGAGTGTGTSTPSTPTTTSQSRLIASSPTLISGITSPPLLDSIKTIQGHGLLGPPKSERGRKKIKAENPGGPPVLVVPYPILASGET

Homologies: Highest protein sequence identity to the following orthologs: Pig - 97%, Cynomolgus monkey - 81%

Alternative gene names: /

Alternative protein names: Zinc finger protein 362

Protein name: zinc finger protein 362

Full length: 420 amino acids

Entry name: ZN362_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3599-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3599-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 149076