Recombinant Human ZNF365 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q70YC5

Gene Name: ZNF365

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Arg281

End Site: Gly380

Coverage: 0.26

Isoelectric Point: 9.5

Core Sequence: RVELAEKQLEYYQSQQASGFVRDLSGHVLTDISSNRKPKCLSRGHPHSVCNHPDLKAHFHPKGRNHLKKAKDDRASMQPAKAIHEQAESSRDLCRPPKKG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 81%, Pig - 81%, Cynomolgus monkey - 97%

Alternative gene names: DBZ; KIAA0844

Alternative protein names: Protein ZNF365; DISC1-binding zinc-finger protein; Protein su48

Protein name: Protein ZNF365 (DISC1-binding zinc-finger protein) (Protein su48)

Full length: 407 amino acids

Entry name: ZN365_HUMAN

• SKU: ASBPP-4078-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4078-20
• Package Unit: 20 μg
• Quantity Unit: STK