Recombinant Human ZNF367 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q7RTV3

Gene Name: ZNF367

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Leu251

End Site: Leu340

Coverage: 0.28

Isoelectric Point: 5

Core Sequence: LKREEPTDTLSKHQAADNKAAAEWLARYWEMREQRTPTLKGKLVQKADQEQQDPLEYLQSDEEDDEKRGAQRRLQEQRERLHGALALIEL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 96%, Pig - 92%, Cynomolgus monkey - 100%

Alternative gene names: ZFF29

Alternative protein names: Zinc finger protein 367; C2H2 zinc finger protein ZFF29

Protein name: zinc finger protein 367

Full length: 350 amino acids

Entry name: ZN367_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3605-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3605-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 195828