Recombinant Human ZNF382 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96SR6

Gene Name: ZNF382

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 56%

Start Site: Lys141

End Site: Ser220

Coverage: 0.15

Isoelectric Point: 8.5

Core Sequence: KVLKNISELVIRNISPIKEKFGDSTGWEKSLLNTKHEKIHPAVNLHKQTERVLSGKQELIQHQKVQAPEQPFDHNECEKS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 56%, Rat - 52%, Pig - 83%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Zinc finger protein 382; KRAB/zinc finger suppressor protein 1; KS1; Multiple zinc finger and krueppel-associated box protein KS1

Protein name: zinc finger protein 382

Full length: 550 amino acids

Entry name: ZN382_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10433-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10433-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 84911