Recombinant Human ZNF418 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8TF45

Gene Name: ZNF418

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Val251

End Site: Cys350

Coverage: 0.17

Isoelectric Point: 8.5

Core Sequence: VHTGKRPYECGECGKSFSHKGSLVQHQRVHTGKRPYECGECGKSFSHKGSLVQHQRVHTGERPYECGECGKSFSQNGTLIKHQRVHTGERPYECEECGKC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Rat - 62%, Pig - 71%, Cynomolgus monkey - 70%

Alternative gene names: KIAA1956

Alternative protein names: Zinc finger protein 418

Protein name: zinc finger protein 418

Full length: 676 amino acids

Entry name: ZN418_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3512-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3512-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 147686