Recombinant Human ZNF420 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8TAQ5

Gene Name: ZNF420

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 44%

Start Site: Val11

End Site: Gly110

Coverage: 0.16

Isoelectric Point: 4.5

Core Sequence: VAIDFSQEEWECLDSAQRDLYRDVMLENYSNLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESNSRDYLEAKGKMEKQQENQKEYFRQG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 44%, Rat - 75%, Pig - 79%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Zinc finger protein 420

Protein name: zinc finger protein 420

Full length: 688 amino acids

Entry name: ZN420_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3627-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3627-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 147923