Recombinant Human ZNF429 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q86V71

Gene Name: ZNF429

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 60%

Start Site: Ile11

End Site: Tyr130

Coverage: 0.19

Isoelectric Point: 7

Core Sequence: IEFSLEEWQCLDTAQQNLYRNVMLENYRNLVFLGIAVSKPDLITCLEKEKEPCKMKRHEMVDEPPVVCSHFAEDFWPEQDIKDSFQKVTLRRYDKRGHENLQLRKGYKTVGDCKLYKGGY

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 60%, Rat - 47%, Pig - 57%, Cynomolgus monkey - 92%

Alternative gene names: /

Alternative protein names: Zinc finger protein 429

Protein name: zinc finger protein 429

Full length: 674 amino acids

Entry name: ZN429_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3454-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3454-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 353088