Recombinant Human ZNF430 Protein

Recombinant Human ZNF430 Protein
SKU
ASBPP-3432-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9H8G1

Gene Name: ZNF430

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Leu11

End Site: Glu160

Coverage: 0.28

Isoelectric Point: 6.5

Core Sequence: LKEASGCPGADRNLLVYSFYEKGPLTFRDVAIEFSLEEWQCLDTAQQDLYRKVMLENYRNLVFLAGIAVSKPDLITCLEQGKEPWNMKRHAMVDQPPVTYSHFAQDLWPEQGIKDSFQEVILRRYGKCGHEDLQLRTGCKSVDECNLHKE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Rat - 39%, Pig - 59%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: Zinc finger protein 430

Protein name: zinc finger protein 430

Full length: 570 amino acids

Entry name: ZN430_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3432-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3432-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 80264
Product information (PDF)
×
MSDS (PDF)
×