Recombinant Human ZNF433 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N7K0

Gene Name: ZNF433

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 37%

Start Site: Asp91

End Site: His160

Coverage: 0.12

Isoelectric Point: 8.5

Core Sequence: DDMLKKTTTGVKSCESSVYGEVGSAHSSLNRHIRDDTGHKAYEYQEYGQKPYKCKYCKKPFNCLSSVQTH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 37%, Rat - 34%, Pig - 56%, Cynomolgus monkey - 89%

Alternative gene names: /

Alternative protein names: Zinc finger protein 433

Protein name: zinc finger protein 433

Full length: 673 amino acids

Entry name: ZN433_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3357-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3357-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 163059