Recombinant Human ZNF439 Protein

Recombinant Human ZNF439 Protein
SKU
ASBPP-3486-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8NDP4

Gene Name: ZNF439

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 31%

Start Site: Lys111

End Site: His180

Coverage: 0.17

Isoelectric Point: 9.5

Core Sequence: KKKASPEVKSCDSFVCEVGLGNSSSNMNIRGDTGHKACECQEYGPKPWKSQQPKKAFRYHPSLRTQERDH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 31%, Rat - 31%, Pig - 47%, Cynomolgus monkey - 80%

Alternative gene names: /

Alternative protein names: Zinc finger protein 439

Protein name: zinc finger protein 439

Full length: 499 amino acids

Entry name: ZN439_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3486-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3486-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 90594
Product information (PDF)
×
MSDS (PDF)
×