Recombinant Human ZNF442 Protein

Recombinant Human ZNF442 Protein
SKU
ASBPP-3383-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9H7R0

Gene Name: ZNF442

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 62%

Start Site: Asp11

End Site: Thr160

Coverage: 0.24

Isoelectric Point: 5.5

Core Sequence: DLFLPDSQTNEERKQYDSVAFEDVAVNFTQEEWALLGPSQKSLYRDVMWETIRNLDCIGMKWEDTNIEDQHRNPRRSLRCHIIERFSESRQPDSTVNEKPPGVDPCKSSVCGEIMGCSFLNCYITFDAGHKPDECQEYGEKPHTHKQCGT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 62%, Rat - 60%, Pig - 52%, Cynomolgus monkey - 88%

Alternative gene names: /

Alternative protein names: Zinc finger protein 442

Protein name: zinc finger protein 442

Full length: 627 amino acids

Entry name: ZN442_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3383-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3383-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 79973
Product information (PDF)
×
MSDS (PDF)
×