Recombinant Human ZNF454 Protein

Recombinant Human ZNF454 Protein
SKU
ASBPP-3488-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8N9F8

Gene Name: ZNF454

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 45%

Start Site: Val141

End Site: His210

Coverage: 0.16

Isoelectric Point: 8

Core Sequence: VLTHPNTPSQECDESGSTMSSSLHSDQSQGFQPSKNAFECSECGKVFSKSSTLNKHQKIHNEKNANQKIH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 45%, Rat - 34%, Pig - 64%, Cynomolgus monkey - 83%

Alternative gene names: /

Alternative protein names: Zinc finger protein 454

Protein name: zinc finger protein 454

Full length: 522 amino acids

Entry name: ZN454_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3488-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3488-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 285676
Product information (PDF)
×
MSDS (PDF)
×