Recombinant Human ZNF460 Protein

Recombinant Human ZNF460 Protein
SKU
ASBPP-3510-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q14592

Gene Name: ZNF460

Expression System: Escherichia coli

Molecular Weight: 31.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 35%

Start Site: Glu11

End Site: His270

Coverage: 0.48

Isoelectric Point: 6

Core Sequence: ESVTFEDVAVTFTQEEWGQLDVTQRALYVEVMLETCGLLVALGDSTKPETVEPIPSHLALPEEVSLQEQLAQGVPRYSYLGQAMDQDGPSEMQEYFLRPGTDPQSEKLHGKMSLEHEGLATADGICSMMIQNQVSPEDALYGFDSYGPVTDSLIHEGENSYKFEEMFNENCFLVQHEQILPRVKPYDCPECGKAFGKSKHLLQHHIIHTGEKPYKCLECGKDFNRRSHLTRHQRTHNGDKPFVCSECGRTFNRGSHLTRH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 35%, Rat - 36%, Pig - 53%, Cynomolgus monkey - 98%

Alternative gene names: ZNF272

Alternative protein names: Zinc finger protein 460; Zinc finger protein 272; Zinc finger protein HZF8

Protein name: zinc finger protein 460

Full length: 562 amino acids

Entry name: ZN460_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3510-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3510-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 10794
Product information (PDF)
×
MSDS (PDF)
×