Recombinant Human ZNF467 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q7Z7K2

Gene Name: ZNF467

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: His31

End Site: Glu110

Coverage: 0.14

Isoelectric Point: 4.5

Core Sequence: HNAQEQMSSSREERALGVCSGHEAPTPEEGAHTEQAEAPCRGQACSAQKAQPVGTCPGEEWMIRKVKVEDEDQEAEEEVE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Rat - 70%, Pig - 72%, Cynomolgus monkey - 92%

Alternative gene names: /

Alternative protein names: Zinc finger protein 467

Protein name: zinc finger protein 467

Full length: 595 amino acids

Entry name: ZN467_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3645-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3645-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 168544