Recombinant Human ZNF486 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96H40

Gene Name: ZNF486

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 57%

Start Site: Arg171

End Site: Cys240

Coverage: 0.17

Isoelectric Point: 10

Core Sequence: RHKRRHTEKKPLKYIEGDKAFNQSSTHTTHKKIDTGEKPYKCEECGKAFNRSSHLTTHKITHTREKPYKC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 57%, Rat - 57%, Pig - 59%, Cynomolgus monkey - 83%

Alternative gene names: KRBO2

Alternative protein names: Zinc finger protein 486; KRAB domain only protein 2

Protein name: zinc finger protein 486

Full length: 463 amino acids

Entry name: ZN486_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3575-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3575-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 90649