Recombinant Human ZNF487 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: B1APH4

Gene Name: ZNF487

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 62%

Start Site: Leu301

End Site: Glu380

Coverage: 0.19

Isoelectric Point: 9

Core Sequence: LHVHQRTHTGEKPYGCNECQKAFGDRSALKVHQRIHTGEKPYELHQRTHTGEKPYACSECGKTFYQKSSLTTHQRTHTRE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 62%, Rat - 59%, Pig - 63%, Cynomolgus monkey - 63%

Alternative gene names: KRBO1; ZNF487P

Alternative protein names: Putative zinc finger protein 487; KRAB domain only protein 1

Protein name: zinc finger protein 487

Full length: 448 amino acids

Entry name: ZN487_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3577-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3577-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 642819