Recombinant Human ZNF487 Protein

Recombinant Human ZNF487 Protein
SKU
ASBPP-3577-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: B1APH4

Gene Name: ZNF487

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 62%

Start Site: Leu301

End Site: Glu380

Coverage: 0.19

Isoelectric Point: 9

Core Sequence: LHVHQRTHTGEKPYGCNECQKAFGDRSALKVHQRIHTGEKPYELHQRTHTGEKPYACSECGKTFYQKSSLTTHQRTHTRE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 62%, Rat - 59%, Pig - 63%, Cynomolgus monkey - 63%

Alternative gene names: KRBO1; ZNF487P

Alternative protein names: Putative zinc finger protein 487; KRAB domain only protein 1

Protein name: zinc finger protein 487

Full length: 448 amino acids

Entry name: ZN487_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3577-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3577-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 642819
Product information (PDF)
×
MSDS (PDF)
×