Recombinant Human ZNF488 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96MN9

Gene Name: ZNF488

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 47%

Start Site: Ser71

End Site: Pro170

Coverage: 0.32

Isoelectric Point: 11

Core Sequence: SAELALLVAPGKPRPGKPLPPKTRGEQRQSAFTELPRMKDRQVDAQAQEREHDDPTGQPGAPQLTQNIPRGPAGSKVFSVWPSGARSEQRSAFSKPTKRP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 47%, Pig - 58%, Cynomolgus monkey - 87%

Alternative gene names: /

Alternative protein names: Zinc finger protein 488

Protein name: zinc finger protein 488

Full length: 340 amino acids

Entry name: ZN488_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3579-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3579-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 118738