Recombinant Human ZNF497 Protein

Recombinant Human ZNF497 Protein
SKU
ASBPP-3584-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6ZNH5

Gene Name: ZNF497

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Asn21

End Site: Ser150

Coverage: 0.29

Isoelectric Point: 6.5

Core Sequence: NVKTATRGLSEGAVSGGWGAWENSTEVPREAGDGQRQQATLGAADEQGGPGRELGPADGGRDGAGPRSEPADRALRPSPLPEEPGCRCGECGKAFSQGSYLLQHRRVHTGEKPYTCPECGKAFAWSSNLS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Rat - 68%, Pig - 75%, Cynomolgus monkey - 89%

Alternative gene names: /

Alternative protein names: Zinc finger protein 497

Protein name: zinc finger protein 497

Full length: 498 amino acids

Entry name: ZN497_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3584-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3584-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 162968
Product information (PDF)
×
MSDS (PDF)
×