Recombinant Human ZNF501 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96CX3

Gene Name: ZNF501

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Arg151

End Site: Gln230

Coverage: 0.30

Isoelectric Point: 8.5

Core Sequence: RHQRSHSGDKPFKCNECGKAFNQSACLMQHQRIHSGEKPYTCTECGKAFTQNSSLVEHERTHTGEKLYKCSECEKTFRKQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Rat - 61%, Pig - 93%, Cynomolgus monkey - 98%

Alternative gene names: ZNF52

Alternative protein names: Zinc finger protein 501; Zinc finger protein 52

Protein name: zinc finger protein 501

Full length: 271 amino acids

Entry name: ZN501_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3587-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3587-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 115560