Recombinant Human ZNF510 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y2H8

Gene Name: ZNF510

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 37%

Start Site: Lys271

End Site: His380

Coverage: 0.16

Isoelectric Point: 8

Core Sequence: KHNSSHTGETSSKDDEFRKNCDKKTLFDHRRTGTGKKHLHLNQCGKSFEKSTVEEYNKLNMGIKHYELNPSGNNFNRKAHLTDPQTAVIEENPLVSNDRTQTWVKSSEYH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 37%, Rat - 34%, Pig - 61%, Cynomolgus monkey - 87%

Alternative gene names: KIAA0972

Alternative protein names: Zinc finger protein 510

Protein name: zinc finger protein 510

Full length: 683 amino acids

Entry name: ZN510_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3492-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3492-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 22869