Recombinant Human ZNF528 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q3MIS6

Gene Name: ZNF528

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 39%

Start Site: Gly131

End Site: Asp210

Coverage: 0.15

Isoelectric Point: 9

Core Sequence: GCKHFEKPVSDNSSVSPLEKISSSVKSHLLNKYRNNFDHAPLLPQEQKAHIREKAYKCNEHGQVFRASASLTNQVIHNAD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 39%, Rat - 35%, Pig - 38%, Cynomolgus monkey - 84%

Alternative gene names: KIAA1827

Alternative protein names: Zinc finger protein 528

Protein name: zinc finger protein 528

Full length: 628 amino acids

Entry name: ZN528_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3502-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3502-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 84436