Recombinant Human ZNF541 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H0D2

Gene Name: ZNF541

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 48%

Start Site: Gln871

End Site: His970

Coverage: 0.07

Isoelectric Point: 10.5

Core Sequence: QEPQVFGTEFCKPLRQVLRPEGDRHSPPGTKKPLDPTAAAPLVVPQSIPVVPVTRHIGSMAMGQEKDGEERDSKESSQQRKRKKRPPPSTAGEPGPAGCH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 48%, Pig - 68%, Cynomolgus monkey - 88%

Alternative gene names: /

Alternative protein names: Zinc finger protein 541

Protein name: zinc finger protein 541

Full length: 1346 amino acids

Entry name: ZN541_HUMAN

• SKU: ASBPP-3642-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3642-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 84215