Recombinant Human ZNF546 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q86UE3

Gene Name: ZNF546

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 61%

Start Site: Glu41

End Site: Glu160

Coverage: 0.15

Isoelectric Point: 5

Core Sequence: ETQGELTSSCGSKTMANVSLAFRDVSIDLSQEEWECLDAVQRDLYKDVMLENYSNLVSLGYTIPKPDVITLLEQEKEPWIVMREGTRNWFTDLEYKYITKNLLSEKNVCKIYLSQLQTGE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 61%, Rat - 47%, Pig - 71%, Cynomolgus monkey - 91%

Alternative gene names: ZNF49

Alternative protein names: Zinc finger protein 546; Zinc finger protein 49

Protein name: zinc finger protein 546

Full length: 836 amino acids

Entry name: ZN546_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3557-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3557-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 339327