Recombinant Human ZNF547 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8IVP9

Gene Name: ZNF547

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 48%

Start Site: Leu121

End Site: Asn200

Coverage: 0.22

Isoelectric Point: 10.5

Core Sequence: LHQHQKEQIREKLSRGDGGRPTFVKNHRVHMAGKTFLCSECGKAFSHKHKLSDHQKIHTGERTYKCSKCGILFMERSTLN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 48%, Rat - 43%, Pig - 55%, Cynomolgus monkey - 92%

Alternative gene names: /

Alternative protein names: Zinc finger protein 547

Protein name: zinc finger protein 547

Full length: 402 amino acids

Entry name: ZN547_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3509-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3509-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 284306