Recombinant Human ZNF551 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q7Z340

Gene Name: ZNF551

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Ser571

End Site: Lys650

Coverage: 0.13

Isoelectric Point: 7.5

Core Sequence: SASLIQHQRVHTGERPYECSECGKSFSQSSSLIQHQRGHTGERPYECSQCGKPFTHKSDLIQHQRVHTGERPYECSECGK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Rat - 67%, Pig - 79%, Cynomolgus monkey - 97%

Alternative gene names: KOX23

Alternative protein names: Zinc finger protein 551; Zinc finger protein KOX23

Protein name: zinc finger protein 551

Full length: 670 amino acids

Entry name: ZN551_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3400-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3400-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 90233