Recombinant Human ZNF552 Protein

Recombinant Human ZNF552 Protein
SKU
ASBPP-3414-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9H707

Gene Name: ZNF552

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 36%

Start Site: Ser131

End Site: Ser210

Coverage: 0.19

Isoelectric Point: 7.5

Core Sequence: SGNFHQHQNEHIGEKPYRGSVEEALFAKRCKLHVSGESSVFSESGKDFLLRSGLLQQEATHTGKSNSKTECVSLFHGGKS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 36%, Rat - 32%, Pig - 44%, Cynomolgus monkey - 83%

Alternative gene names: /

Alternative protein names: Zinc finger protein 552

Protein name: zinc finger protein 552

Full length: 407 amino acids

Entry name: ZN552_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3414-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3414-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 79818
Product information (PDF)
×
MSDS (PDF)
×