Recombinant Human ZNF555 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8NEP9

Gene Name: ZNF555

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Val11

End Site: Gln100

Coverage: 0.16

Isoelectric Point: 4.5

Core Sequence: VDFTLEEWALLDSAQRDLYRDVMLETFQNLASVDDETQFKASGSVSQQDIYGEKIPKESKIATFTRNVSWASVLGKIWDSLSIEDQTTNQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Rat - 66%, Pig - 78%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Zinc finger protein 555

Protein name: zinc finger protein 555

Full length: 628 amino acids

Entry name: ZN555_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3429-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3429-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 148254