Recombinant Human ZNF555 Protein

Recombinant Human ZNF555 Protein
SKU
ASBPP-3429-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8NEP9

Gene Name: ZNF555

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Val11

End Site: Gln100

Coverage: 0.16

Isoelectric Point: 4.5

Core Sequence: VDFTLEEWALLDSAQRDLYRDVMLETFQNLASVDDETQFKASGSVSQQDIYGEKIPKESKIATFTRNVSWASVLGKIWDSLSIEDQTTNQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Rat - 66%, Pig - 78%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Zinc finger protein 555

Protein name: zinc finger protein 555

Full length: 628 amino acids

Entry name: ZN555_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3429-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3429-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 148254
Product information (PDF)
×
MSDS (PDF)
×