Recombinant Human ZNF556 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HAH1

Gene Name: ZNF556

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 47%

Start Site: Lys371

End Site: Phe440

Coverage: 0.19

Isoelectric Point: 10.5

Core Sequence: KCETCGKTYGWSSSLHKHERKHTGEKPVNAASVGKPSGGLCSSKNVRTQIGQKPSKCEKCGKAFSCPKAF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 47%, Rat - 41%, Pig - 52%, Cynomolgus monkey - 91%

Alternative gene names: /

Alternative protein names: Zinc finger protein 556

Protein name: zinc finger protein 556

Full length: 456 amino acids

Entry name: ZN556_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3422-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3422-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 80032