Recombinant Human ZNF557 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N988

Gene Name: ZNF557

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 66%

Start Site: Ala11

End Site: Glu110

Coverage: 0.25

Isoelectric Point: 5

Core Sequence: ASQREGHTEGGELVNELLKSWLKGLVTFEDVAVEFTQEEWALLDPAQRTLYRDVMLENCRNLASLGNQVDKPRLISQLEQEDKVMTEERGILSGTCPDVE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 66%, Rat - 59%, Pig - 73%, Cynomolgus monkey - 90%

Alternative gene names: /

Alternative protein names: Zinc finger protein 557

Protein name: zinc finger protein 557

Full length: 423 amino acids

Entry name: ZN557_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3462-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3462-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 79230