Recombinant Human ZNF561 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N587

Gene Name: ZNF561

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 44%

Start Site: Asp221

End Site: Phe290

Coverage: 0.16

Isoelectric Point: 9.5

Core Sequence: DEKLCEFQEYGRAVTASSHLKQCVAVHTGKKSKKTKKCGKSFTNFSQLYAPVKTHKGEKSFECKECGRSF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 44%, Rat - 42%, Pig - 49%, Cynomolgus monkey - 84%

Alternative gene names: /

Alternative protein names: Zinc finger protein 561

Protein name: zinc finger protein 561

Full length: 486 amino acids

Entry name: ZN561_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3563-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3563-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 93134