Recombinant Human ZNF564 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8TBZ8

Gene Name: ZNF564

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 58%

Start Site: Cys451

End Site: Leu540

Coverage: 0.17

Isoelectric Point: 8.5

Core Sequence: CQVCGKAFDCPSSVRTHERTHTGEKPYECKECGKAFNYASSIRIHERTHTGEKPYECKQCGKTFSYSSSFQRHERAHNGDKPYVKNVGKL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 58%, Rat - 58%, Pig - 77%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Zinc finger protein 564

Protein name: zinc finger protein 564

Full length: 553 amino acids

Entry name: ZN564_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3556-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3556-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 163050