Recombinant Human ZNF565 Protein

Recombinant Human ZNF565 Protein
SKU
ASBPP-3619-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8N9K5

Gene Name: ZNF565

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 71%

Start Site: Gln361

End Site: Pro430

Coverage: 0.16

Isoelectric Point: 9

Core Sequence: QLTVHQRIHTGEKPYECKECGKGFIHSSEVTRHQRIHSGEKPYECKECGKAFRQHAQLTRHQRVHTGDRP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 71%, Rat - 71%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Zinc finger protein 565

Protein name: zinc finger protein 565

Full length: 539 amino acids

Entry name: ZN565_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3619-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3619-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 147929
Product information (PDF)
×
MSDS (PDF)
×