Recombinant Human ZNF566 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q969W8

Gene Name: ZNF566

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 56%

Start Site: Cys171

End Site: Thr250

Coverage: 0.22

Isoelectric Point: 10

Core Sequence: CASKEYRKTFRHGSQFATHEIIHTIEKPYECKECGKSFRHPSRLTHHQKIHTGKKPFECKECGKTFICGSDLTRHHRIHT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 56%, Rat - 62%, Pig - 91%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Zinc finger protein 566

Protein name: zinc finger protein 566

Full length: 418 amino acids

Entry name: ZN566_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3448-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3448-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 84924