Recombinant Human ZNF569 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q5MCW4

Gene Name: ZNF569

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 78%

Start Site: Glu211

End Site: Ser280

Coverage: 0.11

Isoelectric Point: 10

Core Sequence: EKPYECSNCRKAFSHKEKLIKHYKIHSREQSYKCNECGKAFIKMSNLIRHQRIHTGEKPYACKECEKSFS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 78%, Rat - 63%, Pig - 93%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Zinc finger protein 569

Protein name: zinc finger protein 569

Full length: 686 amino acids

Entry name: ZN569_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3450-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3450-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 148266