Recombinant Human ZNF574 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6ZN55

Gene Name: ZNF574

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 80%

Start Site: Glu231

End Site: Glu300

Coverage: 0.09

Isoelectric Point: 6

Core Sequence: EHQATHFPAPVPESQEPALQQEVQASSPAEVPVSQPDPLPASDHSYELRNGEAIGRDRRGRRARRNNSGE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 80%, Rat - 75%, Pig - 85%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Zinc finger protein 574

Protein name: zinc finger protein 574

Full length: 896 amino acids

Entry name: ZN574_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3440-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3440-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 64763