Recombinant Human ZNF577 Protein

Recombinant Human ZNF577 Protein
SKU
ASBPP-3622-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9BSK1

Gene Name: ZNF577

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 52%

Start Site: Phe111

End Site: Gly220

Coverage: 0.24

Isoelectric Point: 9.5

Core Sequence: FGGYGRSCLHIKRDKTLTGVKYHRCVKPSSPKSQLNDLQKICAGGKPHECSVCGRAFSRKAQLIQHQRTERGEKPHGCGECGKTFMRKIQLTEHQRTHTGEKPHECSECG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 52%, Rat - 51%, Pig - 78%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: Zinc finger protein 577

Protein name: zinc finger protein 577

Full length: 485 amino acids

Entry name: ZN577_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3622-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3622-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 84765
Product information (PDF)
×
MSDS (PDF)
×