Recombinant Human ZNF578 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96N58

Gene Name: ZNF578

Expression System: Escherichia coli

Molecular Weight: 32.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 31%

Start Site: Lys11

End Site: Glu270

Coverage: 0.45

Isoelectric Point: 7

Core Sequence: KGKEPGMALPQGRLTFRDVAIEFSLAEWKFLNPAQRALYREVMLENYRNLEAVDISSKRMMKEVLSTGQGNTEVIHTGMLQRHESYHTGDFCFQEIEKDIHDFEFQSQKDERNGHEASMPKIKELMGSTDRHDQRHAGNKPIKDQLGLSFHLHLPELHIFQPEEKIANQVEKSVNDASSISTSQRISCRPETHTPNNYGNNFFHSSLLTQKQEVHMREKSFQCNETGEAFNCSSFVRKHQIIHLGEKQYKFDICGKVFNE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 31%, Rat - 29%, Pig - 44%, Cynomolgus monkey - 75%

Alternative gene names: /

Alternative protein names: Zinc finger protein 578

Protein name: zinc finger protein 578

Full length: 590 amino acids

Entry name: ZN578_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3539-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3539-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 147660