Recombinant Human ZNF583 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96ND8

Gene Name: ZNF583

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 57%

Start Site: Asp121

End Site: Met200

Coverage: 0.15

Isoelectric Point: 9

Core Sequence: DCQSEDWYKNQLGSQEVHLSQLIITHKEILPEVQNKEYNKSWQTFHQDTIFDIQQSFPTKEKAHKHEPQKKSYRKKSVEM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 57%, Pig - 71%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: Zinc finger protein 583; Zinc finger protein L3-5

Protein name: zinc finger protein 583

Full length: 569 amino acids

Entry name: ZN583_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3612-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3612-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 147949