Recombinant Human ZNF587 Protein

Recombinant Human ZNF587 Protein
SKU
ASBPP-3469-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q96SQ5

Gene Name: ZNF587

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 35%

Start Site: Pro181

End Site: Arg260

Coverage: 0.16

Isoelectric Point: 8.5

Core Sequence: PSSGLCQEEAAVEKTDSETMHGPPFQEGKTNYSCGKRTKAFSTKHSVIPHQKLFTRDGCYVCSDCGKSFSRYVSFSNHQR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 35%, Rat - 40%, Pig - 39%, Cynomolgus monkey - 89%

Alternative gene names: /

Alternative protein names: Zinc finger protein 587

Protein name: zinc finger protein 587

Full length: 575 amino acids

Entry name: ZN587_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3469-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3469-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 84914
Product information (PDF)
×
MSDS (PDF)
×