Recombinant Human ZNF587B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: E7ETH6

Gene Name: ZNF587B

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 36%

Start Site: Asp131

End Site: Gly210

Coverage: 0.20

Isoelectric Point: 7

Core Sequence: DSGNFHQHQNEHIGEKPYRGSVEEALFVKRCKLHVSGESSVFSESGKDFLPRSGLLQQEASHTGEKSNSKTECVSPFQCG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 36%, Rat - 33%, Pig - 47%, Cynomolgus monkey - 86%

Alternative gene names: /

Alternative protein names: Zinc finger protein 587B

Protein name: zinc finger protein 587B

Full length: 402 amino acids

Entry name: Z587B_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3446-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3446-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 100293516