Recombinant Human ZNF589 Protein

Recombinant Human ZNF589 Protein
SKU
ASBPP-3644-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q86UQ0

Gene Name: ZNF589

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 59%

Start Site: Asp201

End Site: His270

Coverage: 0.23

Isoelectric Point: 10

Core Sequence: DRISKRAETPGFGAVTFGECALAFNQKSNLFRQKAVTAEKSSDKRQSQVCRECGRGFSRKSQLIIHQRTH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 59%, Rat - 60%, Pig - 41%, Cynomolgus monkey - 99%

Alternative gene names: SZF1

Alternative protein names: Zinc finger protein 589; Stem cell zinc finger protein 1

Protein name: zinc finger protein 589

Full length: 364 amino acids

Entry name: ZN589_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3644-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3644-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 51385
Product information (PDF)
×
MSDS (PDF)
×