Recombinant Human ZNF595 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8IYB9

Gene Name: ZNF595

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 66%

Start Site: Thr241

End Site: Ala320

Coverage: 0.12

Isoelectric Point: 9.5

Core Sequence: TVLNEHKKIHTGEKPYKCEECGKAFTRSTTLNEHKKIHTGEKPYKCKECGKAFRWSTSLNEHKNIHTGEKPYKCKECGKA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 66%, Rat - 62%, Pig - 73%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Zinc finger protein 595

Protein name: zinc finger protein 595

Full length: 648 amino acids

Entry name: ZN595_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3528-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3528-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 152687