Recombinant Human ZNF599 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96NL3

Gene Name: ZNF599

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Glu101

End Site: Pro190

Coverage: 0.16

Isoelectric Point: 6

Core Sequence: ESSFQELLAQRSSRDSRLGQARDEEKLIKIQEGNLRPGTNPHKEICPEKLSYKHDDLEPDDSLGLRVLQERVTPQDALHECDSQGPGKDP

Homologies: Highest protein sequence identity to the following orthologs: Pig - 64%, Cynomolgus monkey - 89%

Alternative gene names: /

Alternative protein names: Zinc finger protein 599

Protein name: zinc finger protein 599

Full length: 588 amino acids

Entry name: ZN599_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3451-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3451-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 148103